SCOPe 2.07: Domain d1b43a1: 1b43 A:220-339

Lineage for d1b43a1 (1b43 A:220-339)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species)

7. Species Pyrococcus furiosus [TaxId:2261] [47818] (1 PDB entry)

8. Domain d1b43a1: 1b43 A:220-339 [18092]
   Other proteins in same PDB: d1b43a2, d1b43b2

Details for d1b43a1

PDB Entry: 1b43, 2 Å

PDB Description: fen-1 from p. furiosus

PDB Compounds: (A:) protein (fen-1)

SCOPe Domain Sequences for d1b43a1:

Sequence; same for both SEQRES and ATOM records:

>d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Pyrococcus furiosus [TaxId: 2261]}
ltreklielailvgtdynpggikgiglkkaleivrhskdplakfqkqsdvdlyaikeffl
nppvtdnynlvwrdpdeegilkflcdehdfseervknglerlkkaiksgkqstleswfkr

Timeline for d1b43a1:

• d1b43a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b43a1 appears in SCOPe 2.06
  
• d1b43a1 appears in the current release, SCOPe 2.08