Lineage for d1b43a1 (1b43 A:220-339)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4452Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 4453Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins)
  6. 4460Protein Fen-1 nuclease [47817] (1 species)
  7. 4461Species Pyrococcus furiosus [TaxId:186497] [47818] (1 PDB entry)
  8. 4462Domain d1b43a1: 1b43 A:220-339 [18092]
    Other proteins in same PDB: d1b43a2, d1b43b2

Details for d1b43a1

PDB Entry: 1b43 (more details), 2 Å

PDB Description: fen-1 from p. furiosus

SCOP Domain Sequences for d1b43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b43a1 a.60.7.1 (A:220-339) Fen-1 nuclease {Pyrococcus furiosus}
ltreklielailvgtdynpggikgiglkkaleivrhskdplakfqkqsdvdlyaikeffl
nppvtdnynlvwrdpdeegilkflcdehdfseervknglerlkkaiksgkqstleswfkr

SCOP Domain Coordinates for d1b43a1:

Click to download the PDB-style file with coordinates for d1b43a1.
(The format of our PDB-style files is described here.)

Timeline for d1b43a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b43a2