SCOPe 2.01: Domain d3m7ta_: 3m7t A:

Lineage for d3m7ta_ (3m7t A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (2 species)
   not a true protein

7. Species Lysobacter enzymogenes [TaxId:69] [189631] (2 PDB entries)

8. Domain d3m7ta_: 3m7t A: [180915]
   automated match to d1boqa_
   complexed with gol, so4; mutant

Details for d3m7ta_

PDB Entry: 3m7t, 1.55 Å

PDB Description: crystal structure of alpha-lytic protease sb2+3 e8a/r105s mutant

PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d3m7ta_:

Sequence; same for both SEQRES and ATOM records:

>d3m7ta_ b.47.1.1 (A:) automated matches {Lysobacter enzymogenes [TaxId: 69]}
anivggiaysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgsttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

Timeline for d3m7ta_:

• d3m7ta_ is new in SCOPe 2.01-stable
  
• d3m7ta_ appears in SCOPe 2.02
  
• d3m7ta_ appears in the current release, SCOPe 2.08