Lineage for d3m7qb_ (3m7q B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063244Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1063245Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1063246Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1063430Protein automated matches [190046] (3 species)
    not a true protein
  7. 1063459Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (1 PDB entry)
  8. 1063460Domain d3m7qb_: 3m7q B: [180912]
    Other proteins in same PDB: d3m7qa_
    automated match to d1shpa_
    complexed with po4

Details for d3m7qb_

PDB Entry: 3m7q (more details), 1.7 Å

PDB Description: Crystal structure of recombinant Kunitz Type serine protease Inhibitor-1 from the Caribbean sea anemone stichodactyla helianthus in complex with bovine pancreatic trypsin
PDB Compounds: (B:) Kunitz-type proteinase inhibitor SHPI-1

SCOPe Domain Sequences for d3m7qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m7qb_ g.8.1.1 (B:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
eaeasicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicral
g

SCOPe Domain Coordinates for d3m7qb_:

Click to download the PDB-style file with coordinates for d3m7qb_.
(The format of our PDB-style files is described here.)

Timeline for d3m7qb_: