Lineage for d1a76a1 (1a76 A:209-316)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001760Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2001761Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2001768Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species)
  7. 2001777Species Methanococcus jannaschii [TaxId:2190] [47816] (2 PDB entries)
  8. 2001779Domain d1a76a1: 1a76 A:209-316 [18091]
    Other proteins in same PDB: d1a76a2
    complexed with mn

Details for d1a76a1

PDB Entry: 1a76 (more details), 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii
PDB Compounds: (A:) flap endonuclease-1 protein

SCOPe Domain Sequences for d1a76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a76a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Methanococcus jannaschii [TaxId: 2190]}
islddlidiaifmgtdynpggvkgigfkrayelvrsgvakdvlkkeveyydeikrifkep
kvtdnyslslklpdkegiikflvdendfnydrvkkhvdklynliankt

SCOPe Domain Coordinates for d1a76a1:

Click to download the PDB-style file with coordinates for d1a76a1.
(The format of our PDB-style files is described here.)

Timeline for d1a76a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a76a2