Lineage for d1a76_1 (1a76 209-316)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444508Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 444509Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 444516Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (4 species)
  7. 444521Species Archaeon Methanococcus jannaschii [TaxId:2190] [47816] (2 PDB entries)
  8. 444523Domain d1a76_1: 1a76 209-316 [18091]
    Other proteins in same PDB: d1a76_2

Details for d1a76_1

PDB Entry: 1a76 (more details), 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii

SCOP Domain Sequences for d1a76_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a76_1 a.60.7.1 (209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii}
islddlidiaifmgtdynpggvkgigfkrayelvrsgvakdvlkkeveyydeikrifkep
kvtdnyslslklpdkegiikflvdendfnydrvkkhvdklynliankt

SCOP Domain Coordinates for d1a76_1:

Click to download the PDB-style file with coordinates for d1a76_1.
(The format of our PDB-style files is described here.)

Timeline for d1a76_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a76_2