Lineage for d1a76_1 (1a76 209-316)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48839Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 48840Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins)
  6. 48851Protein Flap endonuclease-1 [47815] (1 species)
  7. 48852Species Archaeon Methanococcus jannaschii [TaxId:2190] [47816] (2 PDB entries)
  8. 48854Domain d1a76_1: 1a76 209-316 [18091]
    Other proteins in same PDB: d1a76_2

Details for d1a76_1

PDB Entry: 1a76 (more details), 2 Å

PDB Description: flap endonuclease-1 from methanococcus jannaschii

SCOP Domain Sequences for d1a76_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a76_1 a.60.7.1 (209-316) Flap endonuclease-1 {Archaeon Methanococcus jannaschii}
islddlidiaifmgtdynpggvkgigfkrayelvrsgvakdvlkkeveyydeikrifkep
kvtdnyslslklpdkegiikflvdendfnydrvkkhvdklynliankt

SCOP Domain Coordinates for d1a76_1:

Click to download the PDB-style file with coordinates for d1a76_1.
(The format of our PDB-style files is described here.)

Timeline for d1a76_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a76_2