Lineage for d3m6sc1 (3m6s C:1-322)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385590Domain d3m6sc1: 3m6s C:1-322 [180896]
    Other proteins in same PDB: d3m6sa2, d3m6sb_, d3m6sc2, d3m6sd_, d3m6se2, d3m6sf_, d3m6sh_, d3m6si2, d3m6sj_, d3m6sl_
    automated match to d1rd8a_
    complexed with nag

Details for d3m6sc1

PDB Entry: 3m6s (more details), 2.8 Å

PDB Description: crystal structure of h1n1pdm hemagglutinin
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d3m6sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m6sc1 b.19.1.2 (C:1-322) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnvp

SCOPe Domain Coordinates for d3m6sc1:

Click to download the PDB-style file with coordinates for d3m6sc1.
(The format of our PDB-style files is described here.)

Timeline for d3m6sc1: