SCOPe 2.05: Domain d3m6fa_: 3m6f A:

Lineage for d3m6fa_ (3m6f A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
   Uniprot P20701 153-334

8. Domain d3m6fa_: 3m6f A: [180894]
   automated match to d1lfaa_
   complexed with bjz, no3

Details for d3m6fa_

PDB Entry: 3m6f, 1.85 Å

PDB Description: cd11a i-domain complexed with 6-((5s,9r)-9-(4-cyanophenyl)-3-(3,5- dichlorophenyl)-1-methyl-2,4-dioxo-1,3,7- triazaspiro[4.4]non-7-yl) nicotinic acid

PDB Compounds: (A:) Integrin alpha-L

SCOPe Domain Sequences for d3m6fa_:

Sequence; same for both SEQRES and ATOM records:

>d3m6fa_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
mnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy

Timeline for d3m6fa_:

• d3m6fa_ first appeared in SCOPe 2.01
  
• d3m6fa_ appears in SCOPe 2.04
  
• d3m6fa_ is called d3m6fa1 in SCOPe 2.06
  
• d3m6fa_ appears in the current release, SCOPe 2.08, called d3m6fa1