SCOPe 2.08: Domain d1exnb1: 1exn B:186-291

Lineage for d1exnb1 (1exn B:186-291)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)

8. Domain d1exnb1: 1exn B:186-291 [18089]
   Other proteins in same PDB: d1exna2, d1exnb2

Details for d1exnb1

PDB Entry: 1exn, 2.5 Å

PDB Description: t5 5'-exonuclease

PDB Compounds: (B:) 5'-exonuclease

SCOPe Domain Sequences for d1exnb1:

Sequence; same for both SEQRES and ATOM records:

>d1exnb1 a.60.7.1 (B:186-291) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq

Timeline for d1exnb1:

• d1exnb1 first appeared (with stable ids) in SCOP 1.55
  
• d1exnb1 appears in SCOPe 2.07