Lineage for d3m5ya_ (3m5y A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1815849Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1815989Protein automated matches [190130] (11 species)
    not a true protein
  7. 1816080Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)
  8. 1816178Domain d3m5ya_: 3m5y A: [180888]
    automated match to d1dv7a_
    complexed with fmt, gol; mutant

Details for d3m5ya_

PDB Entry: 3m5y (more details), 1.46 Å

PDB Description: crystal structure of the mutant v182a,v201a of orotidine 5'- monophosphate decarboxylase from methanobacterium thermoautotrophicum
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3m5ya_:

Sequence, based on SEQRES records: (download)

>d3m5ya_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgaga
qggdpgetlrfadaiiagrsiyladnpaaaaagiiesik

Sequence, based on observed residues (ATOM records): (download)

>d3m5ya_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgpge
tlrfadaiiagrsiyladnpaaaaagiiesik

SCOPe Domain Coordinates for d3m5ya_:

Click to download the PDB-style file with coordinates for d3m5ya_.
(The format of our PDB-style files is described here.)

Timeline for d3m5ya_: