Lineage for d3m5vc_ (3m5v C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836178Species Campylobacter jejuni [TaxId:197] [189316] (3 PDB entries)
  8. 2836181Domain d3m5vc_: 3m5v C: [180884]
    Other proteins in same PDB: d3m5vb2
    automated match to d1o5ka_
    complexed with cl, fmt, peg, so4

Details for d3m5vc_

PDB Entry: 3m5v (more details), 1.8 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase from Campylobacter jejuni
PDB Compounds: (C:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3m5vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5vc_ c.1.10.0 (C:) automated matches {Campylobacter jejuni [TaxId: 197]}
kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc
ieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyeh
ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdllahe
prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn
inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d3m5vc_:

Click to download the PDB-style file with coordinates for d3m5vc_.
(The format of our PDB-style files is described here.)

Timeline for d3m5vc_: