Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (26 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [189316] (1 PDB entry) |
Domain d3m5vb_: 3m5v B: [180883] automated match to d1o5ka_ complexed with cl, fmt, peg, so4 |
PDB Entry: 3m5v (more details), 1.8 Å
SCOPe Domain Sequences for d3m5vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5vb_ c.1.10.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]} namdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatlthee hrtcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqg lyehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdl laheprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkind elyninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d3m5vb_: