Lineage for d3m5vb_ (3m5v B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 973199Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 973200Protein automated matches [190115] (26 species)
    not a true protein
  7. 973233Species Campylobacter jejuni [TaxId:197] [189316] (1 PDB entry)
  8. 973235Domain d3m5vb_: 3m5v B: [180883]
    automated match to d1o5ka_
    complexed with cl, fmt, peg, so4

Details for d3m5vb_

PDB Entry: 3m5v (more details), 1.8 Å

PDB Description: Crystal Structure of Dihydrodipicolinate Synthase from Campylobacter jejuni
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3m5vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5vb_ c.1.10.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
namdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatlthee
hrtcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqg
lyehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdl
laheprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkind
elyninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d3m5vb_:

Click to download the PDB-style file with coordinates for d3m5vb_.
(The format of our PDB-style files is described here.)

Timeline for d3m5vb_: