| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Campylobacter jejuni [TaxId:197] [189316] (3 PDB entries) |
| Domain d3m5va_: 3m5v A: [180882] Other proteins in same PDB: d3m5vb2 automated match to d1o5ka_ complexed with cl, fmt, peg, so4 |
PDB Entry: 3m5v (more details), 1.8 Å
SCOPe Domain Sequences for d3m5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5va_ c.1.10.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d3m5va_:
View in 3DDomains from other chains: (mouse over for more information) d3m5vb1, d3m5vb2, d3m5vc_, d3m5vd_ |