Lineage for d3m5ub_ (3m5u B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867437Species Campylobacter jejuni [TaxId:197] [189298] (2 PDB entries)
  8. 1867439Domain d3m5ub_: 3m5u B: [180881]
    automated match to d1w23a_
    complexed with gol, mes

Details for d3m5ub_

PDB Entry: 3m5u (more details), 2.15 Å

PDB Description: Crystal Structure of Phosphoserine Aminotransferase from Campylobacter jejuni
PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3m5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5ub_ c.67.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
mrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekakkly
elnddyevlflqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvktvas
seesnfdhiprvefsdnadyayicsnntiygtqyqnypktktplivdassdffsrkvdfs
nialfyggvqknagisglscifirkdmlersknkqipsmlnylthaenqslfntpptfai
ymfnlemdwllnqggldkvheknsqkatmlyecidlsngfykghadkkdrslmnvsfnia
knkdleplfvkeaeeagmiglkghrilggirasiynalnldqvktlcefmkefqgkya

SCOPe Domain Coordinates for d3m5ub_:

Click to download the PDB-style file with coordinates for d3m5ub_.
(The format of our PDB-style files is described here.)

Timeline for d3m5ub_: