SCOPe 2.03: Domain d3m5ub_: 3m5u B:

Lineage for d3m5ub_ (3m5u B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [189298] (2 PDB entries)

8. Domain d3m5ub_: 3m5u B: [180881]
   automated match to d1w23a_
   complexed with gol, mes

Details for d3m5ub_

PDB Entry: 3m5u, 2.15 Å

PDB Description: Crystal Structure of Phosphoserine Aminotransferase from Campylobacter jejuni

PDB Compounds: (B:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3m5ub_:

Sequence; same for both SEQRES and ATOM records:

>d3m5ub_ c.67.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
mrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekakkly
elnddyevlflqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvktvas
seesnfdhiprvefsdnadyayicsnntiygtqyqnypktktplivdassdffsrkvdfs
nialfyggvqknagisglscifirkdmlersknkqipsmlnylthaenqslfntpptfai
ymfnlemdwllnqggldkvheknsqkatmlyecidlsngfykghadkkdrslmnvsfnia
knkdleplfvkeaeeagmiglkghrilggirasiynalnldqvktlcefmkefqgkya

Timeline for d3m5ub_:

• d3m5ub_ first appeared in SCOPe 2.01
  
• d3m5ub_ appears in SCOPe 2.02
  
• d3m5ub_ appears in SCOPe 2.04
  
• d3m5ub_ appears in the current release, SCOPe 2.08