Lineage for d1exna1 (1exn A:186-290)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4452Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 4453Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins)
  6. 4471Protein T5 5'-exonuclease [47813] (1 species)
  7. 4472Species Bacteriophage T5 [TaxId:10726] [47814] (2 PDB entries)
  8. 4475Domain d1exna1: 1exn A:186-290 [18088]
    Other proteins in same PDB: d1exna2, d1exnb2

Details for d1exna1

PDB Entry: 1exn (more details), 2.5 Å

PDB Description: t5 5'-exonuclease

SCOP Domain Sequences for d1exna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exna1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

SCOP Domain Coordinates for d1exna1:

Click to download the PDB-style file with coordinates for d1exna1.
(The format of our PDB-style files is described here.)

Timeline for d1exna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exna2