![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
![]() | Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
![]() | Protein T5 5'-exonuclease [47813] (1 species) |
![]() | Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries) |
![]() | Domain d1exna1: 1exn A:186-290 [18088] Other proteins in same PDB: d1exna2, d1exnb2 |
PDB Entry: 1exn (more details), 2.5 Å
SCOPe Domain Sequences for d1exna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exna1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae
Timeline for d1exna1: