SCOPe 2.04: Domain d3m5qa_: 3m5q A:

Lineage for d3m5qa_ (3m5q A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (7 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [186892] (6 PDB entries)

8. Domain d3m5qa_: 3m5q A: [180871]
   automated match to d1mn1a_
   complexed with ca, gol, hem, man, mn

Details for d3m5qa_

PDB Entry: 3m5q, 0.93 Å

PDB Description: 0.93 a structure of manganese-bound manganese peroxidase

PDB Compounds: (A:) Manganese peroxidase 1

SCOPe Domain Sequences for d3m5qa_:

Sequence; same for both SEQRES and ATOM records:

>d3m5qa_ a.93.1.1 (A:) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa

Timeline for d3m5qa_:

• d3m5qa_ first appeared in SCOPe 2.01
  
• d3m5qa_ appears in SCOPe 2.03
  
• d3m5qa_ appears in SCOPe 2.05
  
• d3m5qa_ appears in the current release, SCOPe 2.08