Lineage for d1xo1b1 (1xo1 B:186-290)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716189Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2716190Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2716223Protein T5 5'-exonuclease [47813] (1 species)
  7. 2716224Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)
  8. 2716234Domain d1xo1b1: 1xo1 B:186-290 [18087]
    Other proteins in same PDB: d1xo1a2, d1xo1b2
    mutant

Details for d1xo1b1

PDB Entry: 1xo1 (more details), 2.5 Å

PDB Description: t5 5'-exonuclease mutant k83a
PDB Compounds: (B:) 5'-exonuclease

SCOPe Domain Sequences for d1xo1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo1b1 a.60.7.1 (B:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

SCOPe Domain Coordinates for d1xo1b1:

Click to download the PDB-style file with coordinates for d1xo1b1.
(The format of our PDB-style files is described here.)

Timeline for d1xo1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xo1b2