SCOPe 2.01: Domain d3m5he_: 3m5h E:

Lineage for d3m5he_ (3m5h E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (4 species)
   not a true protein

7. Species Influenza A virus [TaxId:490450] [189473] (3 PDB entries)

8. Domain d3m5he_: 3m5h E: [180867]
   automated match to d1ti8a1
   complexed with gol, nag

Details for d3m5he_

PDB Entry: 3m5h, 2.7 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin complexed with 3sln

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d3m5he_:

Sequence; same for both SEQRES and ATOM records:

>d3m5he_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 490450]}
gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
atgmrnvpe

Timeline for d3m5he_:

• d3m5he_ is new in SCOPe 2.01-stable
  
• d3m5he_ appears in SCOPe 2.02
  
• d3m5he_ appears in the current release, SCOPe 2.08