Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus [TaxId:490450] [189473] (3 PDB entries) |
Domain d3m5he_: 3m5h E: [180867] Other proteins in same PDB: d3m5hb_, d3m5hd_, d3m5hf_ automated match to d1ti8a1 complexed with gol, nag |
PDB Entry: 3m5h (more details), 2.7 Å
SCOPe Domain Sequences for d3m5he_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5he_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 490450]} gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll atgmrnvpe
Timeline for d3m5he_: