Lineage for d3m5ga_ (3m5g A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047955Protein automated matches [190291] (25 species)
    not a true protein
  7. 2048110Species Influenza A virus [TaxId:490450] [189473] (3 PDB entries)
  8. 2048114Domain d3m5ga_: 3m5g A: [180862]
    Other proteins in same PDB: d3m5gb_, d3m5gd_, d3m5gf_
    automated match to d1ti8a1
    complexed with nag, peg

Details for d3m5ga_

PDB Entry: 3m5g (more details), 2.6 Å

PDB Description: crystal structure of a h7 influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3m5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5ga_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 490450]}
gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt
ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg
irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv
seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr
tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll
atgmrnvpek

SCOPe Domain Coordinates for d3m5ga_:

Click to download the PDB-style file with coordinates for d3m5ga_.
(The format of our PDB-style files is described here.)

Timeline for d3m5ga_: