![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus [TaxId:490450] [189473] (3 PDB entries) |
![]() | Domain d3m5ga_: 3m5g A: [180862] Other proteins in same PDB: d3m5gb_, d3m5gd_, d3m5gf_ automated match to d1ti8a1 complexed with nag, peg |
PDB Entry: 3m5g (more details), 2.6 Å
SCOPe Domain Sequences for d3m5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5ga_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 490450]} gdkiclghhavangtkvntltergievvnatetvettnikkictqgkrptdlgqcgllgt ligppqcdqflefssdliierregtdicypgrftneeslrqilrrsggigkesmgftysg irtngatsactrsgssfyaemkwllsnsdnaafpqmtkayrnprnkpaliiwgvhhsesv seqtklygsgnklitvrsskyqqsftpnpgarridfhwllldpndtvtftfngafiapdr tsffrgeslgvqsdapldsscrgdcfhsggtivsslpfqninsrtvgkcpryvkqkslll atgmrnvpek
Timeline for d3m5ga_: