SCOPe 2.06: Domain d3m52b1: 3m52 B:1-115

Lineage for d3m52b1 (3m52 B:1-115)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)

8. Domain d3m52b1: 3m52 B:1-115 [180858]
   Other proteins in same PDB: d3m52a2, d3m52b2
   automated match to d1r28a_
   complexed with act, zn

Details for d3m52b1

PDB Entry: 3m52, 2.59 Å

PDB Description: Crystal structure of the BTB domain from the Miz-1/ZBTB17 transcription regulator

PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 17

SCOPe Domain Sequences for d3m52b1:

Sequence; same for both SEQRES and ATOM records:

>d3m52b1 d.42.1.0 (B:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvv
hldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalksla

Timeline for d3m52b1:

• d3m52b1 first appeared in SCOPe 2.01, called d3m52b_
  
• d3m52b1 was called d3m52b_ in SCOPe 2.05
  
• d3m52b1 appears in SCOPe 2.07
  
• d3m52b1 appears in the current release, SCOPe 2.08