Lineage for d3m4gl_ (3m4g L:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 948881Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 948922Protein automated matches [190062] (6 species)
    not a true protein
  7. 948966Species Pseudomonas aeruginosa [TaxId:287] [186781] (2 PDB entries)
  8. 948984Domain d3m4gl_: 3m4g L: [180853]
    automated match to d1u1sa1
    complexed with zn

Details for d3m4gl_

PDB Entry: 3m4g (more details), 2.05 Å

PDB Description: h57a hfq from pseudomonas aeruginosa
PDB Compounds: (L:) Protein hfq

SCOPe Domain Sequences for d3m4gl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4gl_ b.38.1.2 (L:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
skghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykaaist
vvpsrpvrlp

SCOPe Domain Coordinates for d3m4gl_:

Click to download the PDB-style file with coordinates for d3m4gl_.
(The format of our PDB-style files is described here.)

Timeline for d3m4gl_: