Lineage for d1taua1 (1tau A:174-289)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738231Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 1738232Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 1738233Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 1738234Species Thermus aquaticus [TaxId:271] [47812] (3 PDB entries)
  8. 1738237Domain d1taua1: 1tau A:174-289 [18085]
    Other proteins in same PDB: d1taua2, d1taua3, d1taua4
    protein/DNA complex; complexed with bgl, zn

Details for d1taua1

PDB Entry: 1tau (more details), 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex
PDB Compounds: (A:) protein (taq polymerase)

SCOPe Domain Sequences for d1taua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taua1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOPe Domain Coordinates for d1taua1:

Click to download the PDB-style file with coordinates for d1taua1.
(The format of our PDB-style files is described here.)

Timeline for d1taua1: