Lineage for d3m4gg_ (3m4g G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787114Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2787115Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2787123Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 2787173Domain d3m4gg_: 3m4g G: [180848]
    automated match to d1u1sa1
    complexed with zn

Details for d3m4gg_

PDB Entry: 3m4g (more details), 2.05 Å

PDB Description: h57a hfq from pseudomonas aeruginosa
PDB Compounds: (G:) Protein hfq

SCOPe Domain Sequences for d3m4gg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4gg_ b.38.1.2 (G:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykaaistvvp
srpvrl

SCOPe Domain Coordinates for d3m4gg_:

Click to download the PDB-style file with coordinates for d3m4gg_.
(The format of our PDB-style files is described here.)

Timeline for d3m4gg_: