Lineage for d3m4ge_ (3m4g E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786929Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 1786930Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 1786938Species Pseudomonas aeruginosa [TaxId:287] [141293] (11 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 1786986Domain d3m4ge_: 3m4g E: [180846]
    automated match to d1u1sa1
    complexed with zn

Details for d3m4ge_

PDB Entry: 3m4g (more details), 2.05 Å

PDB Description: h57a hfq from pseudomonas aeruginosa
PDB Compounds: (E:) Protein hfq

SCOPe Domain Sequences for d3m4ge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4ge_ b.38.1.2 (E:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
kghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykaaistv
vpsrpvrlps

SCOPe Domain Coordinates for d3m4ge_:

Click to download the PDB-style file with coordinates for d3m4ge_.
(The format of our PDB-style files is described here.)

Timeline for d3m4ge_: