SCOP 1.65: Domain d1bgxt1: 1bgx T:174-289

Lineage for d1bgxt1 (1bgx T:174-289)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)

7. Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)

8. Domain d1bgxt1: 1bgx T:174-289 [18083]
   Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt2, d1bgxt3, d1bgxt4

Details for d1bgxt1

PDB Entry: 1bgx, 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxt1:

Sequence; same for both SEQRES and ATOM records:

>d1bgxt1 a.60.7.1 (T:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

Timeline for d1bgxt1:

• d1bgxt1 first appeared (with stable ids) in SCOP 1.55
  
• d1bgxt1 appears in SCOP 1.63
  
• d1bgxt1 appears in SCOP 1.67
  
• d1bgxt1 appears in the current release, SCOPe 2.08