Lineage for d1bgxt1 (1bgx T:174-289)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98772Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 98773Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins)
  6. 98774Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 98775Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)
  8. 98776Domain d1bgxt1: 1bgx T:174-289 [18083]
    Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt2, d1bgxt3, d1bgxt4

Details for d1bgxt1

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab

SCOP Domain Sequences for d1bgxt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxt1 a.60.7.1 (T:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOP Domain Coordinates for d1bgxt1:

Click to download the PDB-style file with coordinates for d1bgxt1.
(The format of our PDB-style files is described here.)

Timeline for d1bgxt1: