Lineage for d3m4da_ (3m4d A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955986Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1955987Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 1955988Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 1955989Protein Alpha-hemolysin [56961] (2 species)
  7. 1955990Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries)
  8. 1955998Domain d3m4da_: 3m4d A: [180828]
    automated match to d7ahla_
    mutant

Details for d3m4da_

PDB Entry: 3m4d (more details), 1.9 Å

PDB Description: crystal structure of the m113n mutant of alpha-hemolysin
PDB Compounds: (A:) alpha-hemolysin

SCOPe Domain Sequences for d3m4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4da_ f.6.1.1 (A:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeynstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d3m4da_:

Click to download the PDB-style file with coordinates for d3m4da_.
(The format of our PDB-style files is described here.)

Timeline for d3m4da_: