SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3m4cc_ (3m4c C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987403Family a.24.3.1: Cytochrome b562 [47176] (2 protein domains)
    automatically mapped to Pfam PF07361
  6. 1987414Protein automated matches [190502] (2 species)
    not a true protein
  7. 1987415Species Escherichia coli [TaxId:562] [187450] (37 PDB entries)
  8. 1987434Domain d3m4cc_: 3m4c C: [180826]
    automated match to d1qq3a_
    complexed with act, hem, zn

Details for d3m4cc_

PDB Entry: 3m4c (more details), 1.9 Å

PDB Description: A Zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d3m4cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4cc_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3m4cc_:

Click to download the PDB-style file with coordinates for d3m4cc_.
(The format of our PDB-style files is described here.)

Timeline for d3m4cc_: