SCOPe 2.05: Domain d3m4cb_: 3m4c B:

Lineage for d3m4cb_ (3m4c B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (34 PDB entries)

8. Domain d3m4cb_: 3m4c B: [180825]
   automated match to d1qq3a_
   complexed with act, hem, zn

Details for d3m4cb_

PDB Entry: 3m4c, 1.9 Å

PDB Description: a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase

PDB Compounds: (B:) Soluble cytochrome b562

SCOPe Domain Sequences for d3m4cb_:

Sequence; same for both SEQRES and ATOM records:

>d3m4cb_ a.24.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d3m4cb_:

• d3m4cb_ first appeared in SCOPe 2.01
  
• d3m4cb_ appears in SCOPe 2.04
  
• d3m4cb_ appears in SCOPe 2.06
  
• d3m4cb_ appears in the current release, SCOPe 2.08