| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (2 families) ![]() Heme-containing proteins |
| Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) |
| Protein automated matches [190502] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187450] (24 PDB entries) |
| Domain d3m4ca_: 3m4c A: [180824] automated match to d1qq3a_ complexed with act, hem, zn |
PDB Entry: 3m4c (more details), 1.9 Å
SCOPe Domain Sequences for d3m4ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m4ca_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwcligqihaalhlanegkvkeaqaaaeqlkttcnachqkyr
Timeline for d3m4ca_: