Class a: All alpha proteins [46456] (144 folds) |
Fold a.60: SAM domain-like [47768] (10 superfamilies) |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) |
Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (5 proteins) |
Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species) |
Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries) |
Domain d1taq_1: 1taq 174-289 [18082] Other proteins in same PDB: d1taq_2, d1taq_3, d1taq_4 |
PDB Entry: 1taq (more details), 2.4 Å
SCOP Domain Sequences for d1taq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1taq_1 a.60.7.1 (174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus} lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle
Timeline for d1taq_1: