| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.7: BAG domain [63491] (1 family) ![]() |
| Family a.7.7.1: BAG domain [63492] (4 proteins) Pfam PF02179 this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain |
| Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries) |
| Domain d3m3zb1: 3m3z B:151-260 [180810] Other proteins in same PDB: d3m3za1, d3m3za2, d3m3zb2 automated match to d1hx1b_ complexed with 3f5 |
PDB Entry: 3m3z (more details), 2.1 Å
SCOPe Domain Sequences for d3m3zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3zb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}
nspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvkat
ieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq
Timeline for d3m3zb1: