Lineage for d1tfr_1 (1tfr 183-305)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282500Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 282501Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 282518Protein T4 RNase H [47809] (1 species)
  7. 282519Species Bacteriophage T4 [TaxId:10665] [47810] (1 PDB entry)
  8. 282520Domain d1tfr_1: 1tfr 183-305 [18081]
    Other proteins in same PDB: d1tfr_2
    complexed with mg

Details for d1tfr_1

PDB Entry: 1tfr (more details), 2.06 Å

PDB Description: rnase h from bacteriophage t4

SCOP Domain Sequences for d1tfr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfr_1 a.60.7.1 (183-305) T4 RNase H {Bacteriophage T4}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef

SCOP Domain Coordinates for d1tfr_1:

Click to download the PDB-style file with coordinates for d1tfr_1.
(The format of our PDB-style files is described here.)

Timeline for d1tfr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfr_2