| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein T4 RNase H [47809] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [47810] (1 PDB entry) |
| Domain d1tfr_1: 1tfr 183-305 [18081] Other proteins in same PDB: d1tfr_2 complexed with mg |
PDB Entry: 1tfr (more details), 2.06 Å
SCOP Domain Sequences for d1tfr_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfr_1 a.60.7.1 (183-305) T4 RNase H {Bacteriophage T4}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef
Timeline for d1tfr_1: