Lineage for d3m3va_ (3m3v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798138Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)
  8. 2798145Domain d3m3va_: 3m3v A: [180807]
    Other proteins in same PDB: d3m3vb2
    automated match to d1uj1b_
    mutant

Details for d3m3va_

PDB Entry: 3m3v (more details), 2.7 Å

PDB Description: SARS-CoV main protease triple mutant STI/A with two N-terminal additional residue (Gly-Ser)
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3m3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3va_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeftpfdvvrqc
sgvtfq

SCOPe Domain Coordinates for d3m3va_:

Click to download the PDB-style file with coordinates for d3m3va_.
(The format of our PDB-style files is described here.)

Timeline for d3m3va_: