Lineage for d1bnp__ (1bnp -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444386Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 444387Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 444388Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 444482Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)
  8. 444491Domain d1bnp__: 1bnp - [18080]

Details for d1bnp__

PDB Entry: 1bnp (more details)

PDB Description: nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures

SCOP Domain Sequences for d1bnp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnp__ a.60.6.1 (-) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
klpgvgtkiaekideflatgklrklek

SCOP Domain Coordinates for d1bnp__:

Click to download the PDB-style file with coordinates for d1bnp__.
(The format of our PDB-style files is described here.)

Timeline for d1bnp__: