Lineage for d3m3ke_ (3m3k E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522215Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2522238Domain d3m3ke_: 3m3k E: [180796]
    automated match to d1m5da_
    complexed with glu, zn

Details for d3m3ke_

PDB Entry: 3m3k (more details), 1.79 Å

PDB Description: ligand binding domain (s1s2) of glua3 (flop)
PDB Compounds: (E:) Glutamate receptor 3

SCOPe Domain Sequences for d3m3ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ke_ c.94.1.1 (E:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d3m3ke_:

Click to download the PDB-style file with coordinates for d3m3ke_.
(The format of our PDB-style files is described here.)

Timeline for d3m3ke_: