SCOPe 2.01: Domain d3m3fa_: 3m3f A:

Lineage for d3m3fa_ (3m3f A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (15 PDB entries)

8. Domain d3m3fa_: 3m3f A: [180787]
   automated match to d1m5da_
   complexed with glu, p99, zn

Details for d3m3fa_

PDB Entry: 3m3f, 2.5 Å

PDB Description: pepa bound to the ligand binding domain of glua3 (flop form)

PDB Compounds: (A:) Glutamate receptor 3

SCOPe Domain Sequences for d3m3fa_:

Sequence; same for both SEQRES and ATOM records:

>d3m3fa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne
qglldklknkwwydkgec

Timeline for d3m3fa_:

• d3m3fa_ is new in SCOPe 2.01-stable
  
• d3m3fa_ appears in SCOPe 2.02
  
• d3m3fa_ appears in the current release, SCOPe 2.08