Lineage for d3m3da_ (3m3d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134065Protein Acetylcholinesterase [53476] (5 species)
  7. 2134137Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (87 PDB entries)
    Uniprot P04058 25-556
  8. 2134191Domain d3m3da_: 3m3d A: [180786]
    automated match to d1evea_
    complexed with nag, peg, pg4, xe

Details for d3m3da_

PDB Entry: 3m3d (more details), 2.34 Å

PDB Description: crystal structure of acetylcholinesterase in complex with xenon
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d3m3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3da_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d3m3da_:

Click to download the PDB-style file with coordinates for d3m3da_.
(The format of our PDB-style files is described here.)

Timeline for d3m3da_: