SCOPe 2.05: Domain d3m38a_: 3m38 A:

Lineage for d3m38a_ (3m38 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
   Uniprot P02185

8. Domain d3m38a_: 3m38 A: [180782]
   automated match to d104ma_
   complexed with hem

Details for d3m38a_

PDB Entry: 3m38, 1.42 Å

PDB Description: the roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: i107e febmb (no metal ion binding to feb site)

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3m38a_:

Sequence; same for both SEQRES and ATOM records:

>d3m38a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefeseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d3m38a_:

• d3m38a_ first appeared in SCOPe 2.01
  
• d3m38a_ appears in SCOPe 2.04
  
• d3m38a_ appears in SCOPe 2.06
  
• d3m38a_ appears in the current release, SCOPe 2.08