![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries) |
![]() | Domain d1dk2a_: 1dk2 A: [18078] |
PDB Entry: 1dk2 (more details)
SCOP Domain Sequences for d1dk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dk2a_ a.60.6.1 (A:) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus) [TaxId: 10116]} skrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakk lpgvgtkiaekideflatgklrklek
Timeline for d1dk2a_: