Lineage for d3m31a1 (3m31 A:56-424)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015699Fold a.227: ERO1-like [110018] (1 superfamily)
    multihelical; consists of 2 four-helical bundles
  4. 2015700Superfamily a.227.1: ERO1-like [110019] (1 family) (S)
    similar active site architecture to (69000)
    automatically mapped to Pfam PF04137
  5. 2015701Family a.227.1.1: ERO1-like [110020] (2 protein domains)
    Pfam PF04137
  6. 2015706Protein automated matches [191199] (1 species)
    not a true protein
  7. 2015707Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189515] (1 PDB entry)
  8. 2015708Domain d3m31a1: 3m31 A:56-424 [180774]
    Other proteins in same PDB: d3m31a2, d3m31a3
    automated match to d1rp4a_
    complexed with cd, fad, nen; mutant

Details for d3m31a1

PDB Entry: 3m31 (more details), 1.85 Å

PDB Description: Structure of the C150A/C295A mutant of S. cerevisiae Ero1p
PDB Compounds: (A:) Endoplasmic oxidoreductin-1

SCOPe Domain Sequences for d3m31a1:

Sequence, based on SEQRES records: (download)

>d3m31a1 a.227.1.1 (A:56-424) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnelnainenirddlsallksdffkyfrldlykqcsfwdandglclnracsvdvvedwdt
lpeywqpeilgsfnndtmkeaddsddeckfldqlaqtskkpvdiedtinycdvndfngkn
avlidltanperftgyggkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasig
thlskeylntktgkwepnldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfa
dlvnkeiknkmdnvisqldtkifnedlvfandlsltlkdefrsrfknvtkimdcvqcdrc
rlwgkiqttgyatalkilfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnm
fekmygkrl

Sequence, based on observed residues (ATOM records): (download)

>d3m31a1 a.227.1.1 (A:56-424) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnelnainenirddlsallksdffkyfrldlykqcsfwdandglclnracsvdwdtlpey
wqpeilgsfnndtmkeaddsddeckfldqlanycdvndfngknavlidltanperftgyg
gkqagqiwstiyqdncftigetgeslakdafyrlvsgfhasigthlskeylntktgkwep
nldlfmarignfpdrvtnmyfnyavvakalwkiqpylpefsfadlvnkeiknkmdnvisq
ldtkifnedlvfandlsltlkdefrsrfknvtkimdcvqcdrcrlwgkiqttgyatalki
lfeindadeftkqhivgkltkyeliallqtfgrlsesiesvnmfekmygkrl

SCOPe Domain Coordinates for d3m31a1:

Click to download the PDB-style file with coordinates for d3m31a1.
(The format of our PDB-style files is described here.)

Timeline for d3m31a1: