| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
| Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries) |
| Domain d3m2vf_: 3m2v F: [180768] Other proteins in same PDB: d3m2va1, d3m2va2, d3m2vb1, d3m2vb2, d3m2vd1, d3m2vd2, d3m2ve1, d3m2ve2 automated match to d1hbmc_ complexed with act, com, edo, f43, mg, tp7, xp8, zn |
PDB Entry: 3m2v (more details), 1.8 Å
SCOPe Domain Sequences for d3m2vf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2vf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl
Timeline for d3m2vf_: