Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries) |
Domain d3m2uf_: 3m2u F: [180766] Other proteins in same PDB: d3m2ua1, d3m2ua2, d3m2ub1, d3m2ub2, d3m2ud1, d3m2ud2, d3m2ue1, d3m2ue2 automated match to d1hbmc_ complexed with act, com, edo, f43, mg, peg, tp7, txz, zn |
PDB Entry: 3m2u (more details), 1.4 Å
SCOPe Domain Sequences for d3m2uf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m2uf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr sqggfn
Timeline for d3m2uf_: