SCOP 1.69: Domain d1bpe_1: 1bpe 12-91

Lineage for d1bpe_1 (1bpe 12-91)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47806] (10 PDB entries)

8. Domain d1bpe_1: 1bpe 12-91 [18076]
   Other proteins in same PDB: d1bpe_3, d1bpe_4
   partly disordered

Details for d1bpe_1

PDB Entry: 1bpe, 3.9 Å

PDB Description: crystal structure of rat dna polymerase beta; evidence for a common polymerase mechanism

SCOP Domain Sequences for d1bpe_1:

Sequence, based on SEQRES records:

>d1bpe_1 a.60.6.1 (12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
nggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtkiae
kideflatgklrklekirrd

Sequence, based on observed residues (ATOM records):

>d1bpe_1 a.60.6.1 (12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Rat (Rattus norvegicus)}
nggitdmlvelanfgaeakklpekideflatgklrklekirrd

Timeline for d1bpe_1:

• d1bpe_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bpe_1 appears in SCOP 1.67
  
• d1bpe_1 appears in SCOP 1.71
  
• d1bpe_1 appears in the current release, SCOPe 2.08, called d1bpea1