| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries) |
| Domain d1bpea1: 1bpe A:12-91 [18076] Other proteins in same PDB: d1bpea2, d1bpea3 partly disordered complexed with dtp fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1bpe (more details), 2.9 Å
SCOPe Domain Sequences for d1bpea1:
Sequence, based on SEQRES records: (download)
>d1bpea1 a.60.6.1 (A:12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtkiae
kideflatgklrklekirrd
>d1bpea1 a.60.6.1 (A:12-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nggitdmlvelanfgaeakklpekideflatgklrklekirrd
Timeline for d1bpea1: